DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ekar and spp-22

DIOPT Version :9

Sequence 1:NP_001036250.1 Gene:Ekar / 43806 FlyBaseID:FBgn0039916 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001025004.2 Gene:spp-22 / 3565459 WormBaseID:WBGene00044283 Length:149 Species:Caenorhabditis elegans


Alignment Length:67 Identity:18/67 - (26%)
Similarity:29/67 - (43%) Gaps:22/67 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LNMDKSLLPETTVDYYVEYVNR-----------------FDSFETVQKVCKLIRVGVQAVF--SP 94
            |..|:.|   ||.:||||.||:                 :|..:..:...::||:..:|:|  .|
 Worm    30 LEKDRML---TTNEYYVEKVNQMAGISCDLCMRAVYGVNYDFIQLKKDFIEMIRLDCEALFHERP 91

  Fly    95 TD 96
            .|
 Worm    92 ED 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EkarNP_001036250.1 PBP1_iGluR_Kainate 24..388 CDD:107377 18/67 (27%)
ANF_receptor 39..371 CDD:279440 18/67 (27%)
PBP2_iGluR_Kainate 402..771 CDD:270432
Lig_chan 533..807 CDD:278489
spp-22NP_001025004.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.