powered by:
Protein Alignment Ekar and spp-22
DIOPT Version :9
Sequence 1: | NP_001036250.1 |
Gene: | Ekar / 43806 |
FlyBaseID: | FBgn0039916 |
Length: | 899 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001025004.2 |
Gene: | spp-22 / 3565459 |
WormBaseID: | WBGene00044283 |
Length: | 149 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 18/67 - (26%) |
Similarity: | 29/67 - (43%) |
Gaps: | 22/67 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LNMDKSLLPETTVDYYVEYVNR-----------------FDSFETVQKVCKLIRVGVQAVF--SP 94
|..|:.| ||.:||||.||: :|..:..:...::||:..:|:| .|
Worm 30 LEKDRML---TTNEYYVEKVNQMAGISCDLCMRAVYGVNYDFIQLKKDFIEMIRLDCEALFHERP 91
Fly 95 TD 96
.|
Worm 92 ED 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1052 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.