DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ekar and Ir7a

DIOPT Version :9

Sequence 1:NP_001036250.1 Gene:Ekar / 43806 FlyBaseID:FBgn0039916 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:645 Identity:102/645 - (15%)
Similarity:220/645 - (34%) Gaps:198/645 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 QQMNEYKYHYLFTSFDLETYDLEDFK-YNFVNITSFRLVDTADVGVKQILKDIGLYSHHIFKKPY 280
            |..|...:|:.         |:...: :||:.:.:.|:...|:  ..|:|:||        .:..
  Fly   105 QAFNTLGFHFT---------DIHSTREFNFLILLTHRMSSRAE--RLQVLRDI--------SRTC 150

  Fly   281 LNLHIKKSTIL-ESEPALMFDSVYVFAIGLQTLEQSHSLTLLNISCEEENSWDGGLSLINYLNAV 344
            :..|.....:| |....::.  ||.:             .|||:.|:                  
  Fly   151 VRFHTSNVILLTEKRDGVVL--VYAY-------------RLLNMDCD------------------ 182

  Fly   345 EWKGLTGPIQFKDGQRVQFKLDLIKLKQHSIVKVGEWTPHGHLNITEPSMFFDAGSMNVTLVVIT 409
                            :...|:||.:.::.:.:      |||          :|.|.|   .|::
  Fly   183 ----------------LSVNLELIDIYKNGLFR------HGH----------EARSFN---RVLS 212

  Fly   410 ILETPYVMMHYG----KNFTGNE----------RFYGFCVDILETISREVGFDYILD------LV 454
            :...|..:..|.    .:|.||.          |..|...::::.::....|..:|:      |.
  Fly   213 LSGCPLQVSWYPLPPFVSFIGNSSDPEERAQIWRLTGIDGELIKLLASIFDFRILLEEPCNKCLS 277

  Fly   455 PDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSE 519
            ||.|        .:.:|...|::...:.:.:|:|:.::...|...||..:....:..:..: :|:
  Fly   278 PDIK--------DDCSGCFDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHM-SSQ 333

  Fly   520 PTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFW 584
            ...:.....|..:.:|:.::::..|:.|.:::..:|         .|...:::         |..
  Fly   334 FGAVAQLAVPFTVIVWLALVVSSLLLVLVLWMRNRL---------VCGRSDLA---------SHA 380

  Fly   585 FTIGTFMQQSP---DIYPRAMSTRIISSTWGFFSLIIVASYTANL-AAFLTTERMINPIENAEDL 645
            ..:.|.:..:|   ...||:...||:.:.|....|::...|...| .:|........|.|.:|.:
  Fly   381 LQVLTTLMGNPLEARSLPRSSRLRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELI 445

  Fly   646 ASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMES 710
            .             |..|......::.|           |...|....:|.|             
  Fly   446 R-------------SNYTLINQEYLDYY-----------PRELTVLTRNGSK------------- 473

  Fly   711 TMLDYI--VQRDCNLTQIGGLLDTKGYGI---ATPKGSPWRDKISL--AILELQERGDIQMLYDK 768
            ...|||  :.::...|....:...:.|.:   :|.:.:..::.|.|  .::.|:....::..:|:
  Fly   474 DRFDYIQGLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDR 538

  Fly   769 ------------WWKNTDETCT-RKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAF 815
                        ::....:.|. ||...:..:...:.|:|..|::.:.:.. :.||||||
  Fly   539 KIKQLLSAGIIGYFVREFDACQYRKPFEEDYEVTPIPLDSFCGLYYISLIW-LSAAVVAF 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EkarNP_001036250.1 PBP1_iGluR_Kainate 24..388 CDD:107377 27/172 (16%)
ANF_receptor 39..371 CDD:279440 24/155 (15%)
PBP2_iGluR_Kainate 402..771 CDD:270432 61/411 (15%)
Lig_chan 533..807 CDD:278489 43/297 (14%)
Ir7aNP_572406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.