DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ekar and T25E4.2

DIOPT Version :9

Sequence 1:NP_001036250.1 Gene:Ekar / 43806 FlyBaseID:FBgn0039916 Length:899 Species:Drosophila melanogaster
Sequence 2:NP_001364710.1 Gene:T25E4.2 / 188897 WormBaseID:WBGene00020804 Length:455 Species:Caenorhabditis elegans


Alignment Length:236 Identity:57/236 - (24%)
Similarity:84/236 - (35%) Gaps:59/236 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 REVGFDYILDLVPDRKY--GAKDPETG---EWNGMVAQLMKY---------------------KA 481
            |.||:...:..|....|  ....|:.|   |:..|..|||..                     .|
 Worm     9 RAVGYQTDVPYVSLSNYCWSFNCPKPGAEVEFLNMTFQLMNSTATIVQIDADIEQSIDMVSNGSA 73

  Fly   482 DLAVGSMTITYARESVIDFTKP--FMNLGISILFKVP----TSEPTRLFSFMNPLAIEIWIYVLI 540
            |:.:.|...|..|...:|||.|  |:..|. ::.::|    .....|||.: :.|||.| .:.||
 Worm    74 DITLVSARQTLDRMKKVDFTTPIGFVYYGY-LVREIPELAVADYIMRLFDY-DTLAILI-SFGLI 135

  Fly   541 AYFLVSLCIYIVG--KLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMS 603
            ...|:.|..:|.|  ..|.::|..| :|.          .:...|.|.|     .||      :.
 Worm   136 IGALLYLYTWIFGLRVRSLLDWMFI-SCS----------GIIHQFMFRI-----SSP------IC 178

  Fly   604 TRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAED 644
            ..::...|....|:|:..|.|.|.:||........|.|..|
 Worm   179 ALVLIGFWLLCCLVIITYYEAKLKSFLLLSHHRGTIFNTLD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EkarNP_001036250.1 PBP1_iGluR_Kainate 24..388 CDD:107377
ANF_receptor 39..371 CDD:279440
PBP2_iGluR_Kainate 402..771 CDD:270432 57/236 (24%)
Lig_chan 533..807 CDD:278489 27/114 (24%)
T25E4.2NP_001364710.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.