DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gat and CG31904

DIOPT Version :9

Sequence 1:NP_651930.2 Gene:Gat / 43805 FlyBaseID:FBgn0039915 Length:636 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:145 Identity:43/145 - (29%)
Similarity:65/145 - (44%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RGSWSSKMDFI---------------LSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLA 107
            ||.|:...||.               ||..|:..|              |...||:.|::.:...
  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG--------------GWLLFIIAYLMGMLFY 134

  Fly   108 GIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRAD 172
            .:|:|.::..|||..:.|.:..|::||||||||||..:::.....||.:.....:.|...|:...
  Fly   135 SLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPV 199

  Fly   173 VPWRTCNNWWNTVNC 187
            :||.:|||.|||..|
  Fly   200 IPWMSCNNSWNTQEC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GatNP_651930.2 SLC6sbd-TauT-like 58..611 CDD:271387 43/145 (30%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 33/92 (36%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.