DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_065685.1 Gene:GDF3 / 9573 HGNCID:4218 Length:364 Species:Homo sapiens


Alignment Length:227 Identity:60/227 - (26%)
Similarity:95/227 - (41%) Gaps:50/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 IEFDVTKAVRSWLNKSHENLG--IEIQCDKCKSIGARILSDFSP-STPPRSTASSDEHLNLMPVL 543
            :.|::....:.|.:...:|.|  :||...:.:..|.    :|.| .|..|...|.  |.:|:.| 
Human   179 VHFNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGV----NFQPEDTCARLRCSL--HASLLVV- 236

  Fly   544 NIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQR--CCRNQL 606
                  |||..|                        .|.|  ||.:......||..:  |.|:||
Human   237 ------TLNPDQ------------------------CHPS--RKRRAAIPVPKLSCKNLCHRHQL 269

  Fly   607 DVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSK 668
            .:.|:.:...::|:.||.|.|.||||.||   .....:.::|.:|:|:...| ...|:..|.|:|
Human   270 FINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVD-PEIPQAVCIPTK 333

  Fly   669 LEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |..:.:|:.|.|  |.:.:..:.||.|.||.|
Human   334 LSPISMLYQDNN--DNVILRHYEDMVVDECGC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 5/25 (20%)
TGF_beta 599..700 CDD:278448 34/105 (32%)
GDF3NP_065685.1 TGFb_propeptide <109..220 CDD:279078 9/44 (20%)
TGFB 264..364 CDD:214556 35/103 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.