DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF15

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_004855.2 Gene:GDF15 / 9518 HGNCID:30142 Length:308 Species:Homo sapiens


Alignment Length:102 Identity:22/102 - (21%)
Similarity:48/102 - (47%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 RCCR-NQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPC 663
            |||| :.:..:.:.:...:::|.|:......|.|.||.:...|:.||.:::.:.:......|.||
Human   209 RCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPC 273

  Fly   664 CTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |.|:....:.::   :.....:.:.|:.|:...:|.|
Human   274 CVPASYNPMVLI---QKTDTGVSLQTYDDLLAKDCHC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 21/100 (21%)
GDF15NP_004855.2 MscS_TM <23..>147 CDD:331130
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..177
TGFB 211..308 CDD:214556 20/100 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.