DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp7

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001178785.1 Gene:Bmp7 / 85272 RGDID:620743 Length:430 Species:Rattus norvegicus


Alignment Length:280 Identity:66/280 - (23%)
Similarity:119/280 - (42%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 NSSQQLTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHEN 500
            |.:.|:|  |||:|..:..|:     :.||.|.....|       |:.||:|.....|:.....|
  Rat   186 NETFQIT--VYQVLQEHSGRESDLFLLDSRTIWASEEG-------WLVFDITATSNHWVVNPRHN 241

  Fly   501 LGIEIQCDKC--KSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIG-HGTLNSQQHGDA--- 559
            ||:::..:..  :||..::                         ..:|| ||..|.|....|   
  Rat   242 LGLQLSVETLDGQSINPKL-------------------------AGLIGRHGPQNKQPFMVAFFK 281

  Fly   560 --DIHQIMLTNNRSDQYVHHRS----NHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEF 618
              ::|...:.:....|...:||    |.::........|:.....|.|.:::|.|:|:.:...::
  Rat   282 ATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDW 346

  Fly   619 ILQPKVFDAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDEN 680
            |:.|:.:.|.||.|.|....|.   |.:||::|:|:...:....|:|||.|::|..:.:|:.|: 
  Rat   347 IIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDD- 410

  Fly   681 HSDKLKISTWSDMQVVECAC 700
             |..:.:..:.:|.|..|.|
  Rat   411 -SSNVILKKYRNMVVRACGC 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 19/68 (28%)
TGF_beta 599..700 CDD:278448 30/103 (29%)
Bmp7NP_001178785.1 TGFb_propeptide 35..279 CDD:395559 28/126 (22%)
TGF_beta_BMP7 324..430 CDD:381667 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.