DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and mstnb

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_571094.2 Gene:mstnb / 798441 ZFINID:ZDB-GENE-990415-165 Length:374 Species:Danio rerio


Alignment Length:248 Identity:63/248 - (25%)
Similarity:99/248 - (39%) Gaps:63/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 RRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSP 523
            |.:|.|.||:. |.|.    |.|...||.:.:..||.:...|.||||.....|.      :|.:.
Zfish   185 RHRIRSLKIDV-NAGV----TSWQSIDVKQVLTVWLKQPETNRGIEINAYDAKG------NDLAV 238

  Fly   524 STPPRSTASSDEHLNLMPVLNI-IGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRK 587
            :    ||.:.::  .|:|.:.: |..|....::....|..:     |.|:               
Zfish   239 T----STETGED--GLLPFMEVKISEGPKRIRRDSGLDCDE-----NSSE--------------- 277

  Fly   588 DKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIW 652
                       .||||..|.|.|:.. |:::|:.||.:.|.||.|.|...:...:.|..|.    
Zfish   278 -----------SRCCRYPLTVDFEDF-GWDWIIAPKRYKANYCSGECDYMYLQKYPHTHLV---- 326

  Fly   653 QEDHKRAPR----PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
               :|.:||    |||||:|:..:.:|:.  |..:::.......|.|..|.||
Zfish   327 ---NKASPRGTAGPCCTPTKMSPINMLYF--NGKEQIIYGKIPSMVVDRCGCS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/46 (37%)
TGF_beta 599..700 CDD:278448 32/104 (31%)
mstnbNP_571094.2 TGFb_propeptide 38..252 CDD:279078 24/83 (29%)
TGFB 280..374 CDD:214556 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.