DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and gdf10b

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001165060.2 Gene:gdf10b / 794493 ZFINID:ZDB-GENE-120316-1 Length:385 Species:Danio rerio


Alignment Length:259 Identity:55/259 - (21%)
Similarity:89/259 - (34%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 QDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYS-SSLATNFR----RGPGSR-----KNKI 415
            :.|....|.||   |.||:.|.|.|:.:.......|. :||...|.    ..|.|.     :.|.
Zfish   119 EKTHKCTLDFP---AVDASVHKDVIEVSFKHPSAFYERASLEEEFEYTIILNPSSSSVPHLQEKS 180

  Fly   416 SQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIE-FGNVGFQE--- 476
            |.....|.:...|. ..|::|||          .|.|.:......||.|..:. :.||...:   
Zfish   181 SHSCFEDELGYLCE-TKVHVNQS----------VVVQWVVLKFEGKIASIPVHTYKNVSVPQLEP 234

  Fly   477 --TRTQWIEFDVTKAVR--------SWLNKSHENLGIEIQCDKCKSIGARIL-----SDFS-PST 525
              .:|:||...:..::.        .|.  .|:|..   :..|..||...|:     :.:| |.:
Zfish   235 ASAKTEWIAAILCGSIALLFIVFVVLWF--IHKNFS---KIPKVPSILRNIVTRPYSTPYSQPES 294

  Fly   526 PPRSTASSDEH-----LNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDST 584
            |..|:.:|..|     .|..|:|:.:         |.:.......|.|...::.......:||:
Zfish   295 PHVSSMTSATHTPVLLYNNEPLLDFV---------HDEVSKTTDTLVNTEEEEPAPSEEEYDSS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 13/77 (17%)
TGF_beta 599..700 CDD:278448
gdf10bNP_001165060.2 FN3 21..104 CDD:328772
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.