DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and TGFB3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens


Alignment Length:441 Identity:102/441 - (23%)
Similarity:174/441 - (39%) Gaps:96/441 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 TRDLHFLSITTNGFNDISNKRLRHRRS--LKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFP- 371
            |..|...:.||..|..|..||:...|.  |.|: ||...|:.               .::.|.| 
Human    19 TVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKL-RLTSPPEP---------------TVMTHVPY 67

  Fly   372 ----LTNA--------------------QDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSR- 411
                |.|:                    .::.::..:|.:.::...|...:.||. ..:|..|: 
Human    68 QVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAV-CPKGITSKV 131

  Fly   412 -KNKISQISGNDNIERHCNFGDVNL-NQSNKNSSQQLTLKVYQLLSAN----RRRKITSRKIEFG 470
             :..:|.:..|........|..:.: |.|:|.:.|::.|  :|:|..:    ::|.|..:.:   
Human   132 FRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIEL--FQILRPDEHIAKQRYIGGKNL--- 191

  Fly   471 NVGFQETR--TQWIEFDVTKAVRSWLNKSHENLGIE--IQCDKCKSIGARILSDFSPSTPPRSTA 531
                 .||  .:|:.||||..||.||.:...|||:|  |.| .|.:        |.|        
Human   192 -----PTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHC-PCHT--------FQP-------- 234

  Fly   532 SSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYV-------HHRSNHDSTWRKDK 589
            :.|...|:..|:.|...|..|...||..|:.::....:..:.::       |...|.....::.|
Human   235 NGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKK 299

  Fly   590 W---TNNCYK-LHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSL 650
            .   ||.|:: |.:.||...|.:.|:...|::::.:||.:.|.:|.|.||...:....|:.:..|
Human   300 RALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGL 364

  Fly   651 IWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ....:.:.:..|||.|..||.|.||:......   |:...|:|.|..|.||
Human   365 YNTLNPEASASPCCVPQDLEPLTILYYVGRTP---KVEQLSNMVVKSCKCS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 21/71 (30%)
TGF_beta 599..700 CDD:278448 28/100 (28%)
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 51/233 (22%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7139
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.