DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and TGFB1

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_011525544.1 Gene:TGFB1 / 7040 HGNCID:11766 Length:391 Species:Homo sapiens


Alignment Length:360 Identity:78/360 - (21%)
Similarity:128/360 - (35%) Gaps:111/360 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 EQDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNI 424
            :|.|.:|.:.|..:..::|......:..|.:||:.|                  |:       .:
Human   125 KQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRL------------------KL-------KV 164

  Fly   425 ERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKA 489
            |:|                    :::||..|.|..|.:::|.:.      .....:|:.||||..
Human   165 EQH--------------------VELYQKYSNNSWRYLSNRLLA------PSDSPEWLSFDVTGV 203

  Fly   490 VRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQ 554
            ||.||::..|..|..:.                      :..|.|...|.:.|            
Human   204 VRQWLSRGGEIEGFRLS----------------------AHCSCDSRDNTLQV------------ 234

  Fly   555 QHGDADIHQIMLTNNRSDQYVHH---------------RSNH--DSTWRKDKWTNNCY-KLHQRC 601
                 ||:....|..|.|....|               |:.|  .|..|:...||.|: ...:.|
Human   235 -----DINAGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNC 294

  Fly   602 CRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPCCTP 666
            |..||.:.|:...|:::|.:||.:.|.:|.|.||...:....::.:.:|..|.:...:..|||.|
Human   295 CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP 359

  Fly   667 SKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ..||.|.|::.   ...|.|:...|:|.|..|.||
Human   360 QALEPLPIVYY---VGRKPKVEQLSNMIVRSCKCS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/63 (27%)
TGF_beta 599..700 CDD:278448 30/100 (30%)
TGFB1XP_011525544.1 TGFb_propeptide 30..262 CDD:395559 39/226 (17%)
TGF_beta_TGFB1 293..391 CDD:381654 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.