DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp8a

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001102902.1 Gene:Bmp8a / 680931 RGDID:1585858 Length:399 Species:Rattus norvegicus


Alignment Length:295 Identity:58/295 - (19%)
Similarity:114/295 - (38%) Gaps:94/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 LTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIE- 504
            |.:.:::::.....|:     :..:.:..|:.|       |:..|:|.|...||...:::||:. 
  Rat   158 LHISMFEVVQERSNRESDLFFLDLQTLRSGDEG-------WLVLDITAASDRWLLNHNKDLGLRL 215

  Fly   505 -IQCDKCKSIG---ARILSDFSP--------------STPPRSTAS-----------SDE--HLN 538
             ::.:...|:.   |.:|...:|              |:|.|:..:           ::|  |.|
  Rat   216 YVETEDGHSLDPGLAGLLGQTAPRSRQPFMVTFFRASSSPVRTPRAVRPLKRRQPKKTNELPHPN 280

  Fly   539 LMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCR 603
            .:|.:...|||:                                             :..:.|.|
  Rat   281 KLPGIFDDGHGS---------------------------------------------RGREVCRR 300

  Fly   604 NQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP-PRHN--PAHHHALLQSLIWQEDHKRAPRPCCT 665
            ::|.|:|:.:...::::.|:.:.|.||.|.|. |..:  .|.:||:||||:........|:.||.
  Rat   301 HELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPLDSCMNATNHAILQSLVHLMKPDVVPKACCA 365

  Fly   666 PSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |:||....:|:.|.  |:.:.:....:|.|..|.|
  Rat   366 PTKLSATSVLYYDS--SNNVILRKHRNMVVKACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 12/66 (18%)
TGF_beta 599..700 CDD:278448 31/103 (30%)
Bmp8aNP_001102902.1 TGFb_propeptide 32..248 CDD:279078 16/96 (17%)
TGF_beta 298..398 CDD:278448 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.