DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp8b

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_002729572.1 Gene:Bmp8b / 679119 RGDID:1591873 Length:399 Species:Rattus norvegicus


Alignment Length:401 Identity:81/401 - (20%)
Similarity:144/401 - (35%) Gaps:135/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 NQNPKKHQNYGDLLRGEQDTMNILLHFPLTNAQDAN---FHHDKIDEANVRLMLLYSSSLATNFR 405
            |..|:.|.:..||:   ...:||:.|......|:.:   ||.|      :..:....:..|..||
  Rat    89 NGPPQPHLHRADLI---MSFVNIVEHDRTLGYQEPHWKEFHFD------LTQIPAGEAVTAAEFR 144

  Fly   406 --RGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIE 468
              :.|.:..         .|...|.:..:|...:||:.|  .|.....|.|.:            
  Rat   145 IYKEPSTHP---------PNTTLHISMFEVVQERSNRES--DLFFLDLQTLRS------------ 186

  Fly   469 FGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIE--IQCDKCKSIG---ARILSDFSP----- 523
             |:.|       |:..|:|.|...||...:::||:.  ::.:...|:.   |.:|...:|     
  Rat   187 -GDEG-------WLVLDITAASDRWLLNHNKDLGLRLYVETEDGHSLDPGLAGLLGQTAPRSRQP 243

  Fly   524 ---------STPPRS--TA---------------SSDEHLNLMPVLNIIGHGTLNSQQHGDADIH 562
                     .:|.|:  ||               :|::||.:..    .|||:|      |.:: 
  Rat   244 FMVGFFKASQSPVRAPRTARPLKKKKLNQVNQLPNSNKHLGIFD----DGHGSL------DREV- 297

  Fly   563 QIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDA 627
                                                  |.|::|.|:|:.:...:.::.|:.:.|
  Rat   298 --------------------------------------CRRHELYVSFRDLGWLDSVIAPQGYSA 324

  Fly   628 GYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKIST 689
            .||.|.|....|.   :.:||.:|:|:........|:.||.|:||..:.:|:.|.|::..|:.. 
  Rat   325 YYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIVPKVCCVPTKLSAISLLYYDRNNNVILRRE- 388

  Fly   690 WSDMQVVECAC 700
             .:|.|..|.|
  Rat   389 -RNMVVQACGC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 14/65 (22%)
TGF_beta 599..700 CDD:278448 29/103 (28%)
Bmp8bXP_002729572.1 TGFb_propeptide 32..248 CDD:279078 39/198 (20%)
TGF_beta 298..398 CDD:278448 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.