DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and BMP7

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001710.1 Gene:BMP7 / 655 HGNCID:1074 Length:431 Species:Homo sapiens


Alignment Length:278 Identity:63/278 - (22%)
Similarity:120/278 - (43%) Gaps:54/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 SQQLTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLG 502
            ::...:.|||:|..:..|:     :.||.:.....|       |:.||:|.....|:.....|||
Human   187 NETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEG-------WLVFDITATSNHWVVNPRHNLG 244

  Fly   503 IEIQCDKC--KSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIG-HGTLNSQQHGDA----- 559
            :::..:..  :||..::                         ..:|| ||..|.|....|     
Human   245 LQLSVETLDGQSINPKL-------------------------AGLIGRHGPQNKQPFMVAFFKAT 284

  Fly   560 DIHQIMLTNNRSDQYVHHRS----NHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFIL 620
            ::|...:.:..|.|...:||    |.::....:...|:.....|.|.:::|.|:|:.:...::|:
Human   285 EVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWII 349

  Fly   621 QPKVFDAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHS 682
            .|:.:.|.||.|.|....|.   |.:||::|:|:...:.:..|:|||.|::|..:.:|:.|:  |
Human   350 APEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDD--S 412

  Fly   683 DKLKISTWSDMQVVECAC 700
            ..:.:..:.:|.|..|.|
Human   413 SNVILKKYRNMVVRACGC 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 16/67 (24%)
TGF_beta 599..700 CDD:278448 30/103 (29%)
BMP7NP_001710.1 TGFb_propeptide 35..280 CDD:366248 24/124 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..311 5/19 (26%)
TGF_beta_BMP7 325..431 CDD:381667 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.