DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and BMP4

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001334841.1 Gene:BMP4 / 652 HGNCID:1071 Length:455 Species:Homo sapiens


Alignment Length:569 Identity:113/569 - (19%)
Similarity:201/569 - (35%) Gaps:155/569 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 ETNQHPIIRAKSTPKMGLKNVFESFSKQSRDSIYNASSNKYSLINV------SQSKNFPQLFNKK 212
            |...|.::.:::|........|:...  ||.::.|.....|:|.:|      |.:...|:...||
Human    19 EARSHSVVPSRATHCCSFPEPFQQVC--SRLAVKNHGLLLYALFSVILLGGASHASLIPETGKKK 81

  Fly   213 LSVQWINTVPIQSRQTRE-TRD--------IGLETKRHSKPSKRVDETRLKHLVLKGLGIKKLPD 268
            ::....:....:|.|:.| .||        .||  :|..:|||..                .:||
Human    82 VAEIQGHAGGRRSGQSHELLRDFEATLLQMFGL--RRRPQPSKSA----------------VIPD 128

  Fly   269 MRKVNISQAEYSSKYIEYLSRLRSNQEKGNSYFNNFMGASFTRDLHFLSITTNGFNDISNKRLRH 333
                          |:..|.||:|.:|:.....:.  |..:.......:.|...|:         
Human   129 --------------YMRDLYRLQSGEEEEEQIHST--GLEYPERPASRANTVRSFH--------- 168

  Fly   334 RRSLKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYSS 398
                            |:.:.:.:.|..:.......|.|::..:    ::.|..|.:||      
Human   169 ----------------HEEHLENIPGTSENSAFRFLFNLSSIPE----NEVISSAELRL------ 207

  Fly   399 SLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKIT 463
                 ||          .|:....:.||  .|..:|:.:..|..:        :::..:...::.
Human   208 -----FR----------EQVDQGPDWER--GFHRINIYEVMKPPA--------EVVPGHLITRLL 247

  Fly   464 SRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSI----GARILSDFSPS 524
            ..::...||      |:|..|||:.||..|..:...|.|:.|:.......    |..:  ..|.|
Human   248 DTRLVHHNV------TRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHV--RISRS 304

  Fly   525 TPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDK 589
            .|    ..|.....|.|:|...||         |...|.:...........||            
Human   305 LP----QGSGNWAQLRPLLVTFGH---------DGRGHALTRRRRAKRSPKHH------------ 344

  Fly   590 WTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLI 651
             :....|.::.|.|:.|.|.|..:...::|:.|..:.|.||||.||   ..|..:.:||::|:|:
Human   345 -SQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLV 408

  Fly   652 WQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
             ...:...|:.||.|::|..:.:|::||  .||:.:..:.:|.|..|.|
Human   409 -NSVNSSIPKACCVPTELSAISMLYLDE--YDKVVLKNYQEMVVEGCGC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 12/63 (19%)
TGF_beta 599..700 CDD:278448 32/103 (31%)
BMP4NP_001334841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.