DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and BMP3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001192.4 Gene:BMP3 / 651 HGNCID:1070 Length:472 Species:Homo sapiens


Alignment Length:453 Identity:98/453 - (21%)
Similarity:155/453 - (34%) Gaps:170/453 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 DKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKNSS---- 443
            ||:.|..:||...||:..|.   |.|||       :.|.....|.....:.|..:|.:.::    
Human    54 DKVSEHMLRLYDRYSTVQAA---RTPGS-------LEGGSQPWRPRLLREGNTVRSFRAAAAETL 108

  Fly   444 QQLTLKVYQLLSANRRRKITSRKI-----EFGNVG----------------------------FQ 475
            ::..|.::.|.|..:...|.|..:     |.||:.                            |.
Human   109 ERKGLYIFNLTSLTKSENILSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFS 173

  Fly   476 ETRTQ------------------WIEFDVTKAVRSWLNKSHEN----LGIEIQCDKCKSIGAR-- 516
            ..::|                  |:..|:|:.:|    |:.||    :|..| ..|.:.:..|  
Human   174 RNQSQLLGHLSVDMAKSHRDIMSWLSKDITQLLR----KAKENEEFLIGFNI-TSKGRQLPKRRL 233

  Fly   517 --------ILSDFSPSTPPRSTASS---------------DEHLN---------------LMPVL 543
                    :.::.:..:.|.|..||               |.|:.               |:|:.
Human   234 PFPEPYILVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAALSIERRKKRSTGVLLPLQ 298

  Fly   544 N--IIG----------------HGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTW----- 585
            |  :.|                :.||.:|....:       .|.:..:...||.:....:     
Human   299 NNELPGAEYQYKKDEVWEERKPYKTLQAQAPEKS-------KNKKKQRKGPHRKSQTLQFDEQTL 356

  Fly   586 ---RKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHH 644
               |:.:|..     .:.|.|..|.|.|..|...|:|:.||.|||.||.|.|.   |:.....:|
Human   357 KKARRKQWIE-----PRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNH 416

  Fly   645 ALLQSLIWQEDHKRA-------PRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |.:||::      ||       |.|||.|.|:..|.||..|||.:..||:  :.:|.|..|||
Human   417 ATIQSIV------RAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKV--YPNMTVESCAC 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/122 (15%)
TGF_beta 599..700 CDD:278448 41/110 (37%)
BMP3NP_001192.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..350 6/36 (17%)
TGF_beta_BMP3 363..472 CDD:381663 44/122 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.