DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Inhbc

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_072136.1 Gene:Inhbc / 64549 RGDID:621194 Length:351 Species:Rattus norvegicus


Alignment Length:343 Identity:71/343 - (20%)
Similarity:121/343 - (35%) Gaps:102/343 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 SLATNFRRGPGSRKNKISQISGNDNIERH--CNFGDVNLNQSNK--------------------- 440
            :|.|..||..|:|...:.:   :|..:.:  .:|.|..|:..|:                     
  Rat    71 ALKTALRRLRGTRAETLLE---HDQRQEYEIISFADTGLSNINQTRLEFHFSDRTTGGVEVLQTR 132

  Fly   441 ---------NSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNK 496
                     |::|.:.::|..|...:....:||:.:      .|...:.|.:.            
  Rat   133 FMFFMQLPPNTTQTMNIRVLVLRPYDTNLTLTSQYM------LQVDASGWYQL------------ 179

  Fly   497 SHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADI 561
               .||.|.|                       .|.|..||    .|.::....|         .
  Rat   180 ---LLGPEAQ-----------------------AACSQGHL----TLELVPESQL---------A 205

  Fly   562 HQIMLTNNRSDQ-YVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVF 625
            |..::.:..|.: :|..:...:...|..:...||..|.:.|||.:..|.|:.|...::|:||:.:
  Rat   206 HSSLILDGVSHRPFVAAQVRVEGKHRVRRRGINCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGY 270

  Fly   626 DAGYCHGRCP------PRHNPAHHHALLQSLIWQEDHKRAPR-PCCTPSKLEMLEILHVDENHSD 683
            ...:|.|:||      |..:.:.|.|:|..|....|...|.| .||.|:....|.:|:.|.: |:
  Rat   271 AMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRD-SN 334

  Fly   684 KLKISTWSDMQVVECACS 701
            .:|... .||.|..|.||
  Rat   335 IVKTDI-PDMVVEACGCS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 10/63 (16%)
TGF_beta 599..700 CDD:278448 33/107 (31%)
InhbcNP_072136.1 TGF_beta_INHBC_E 246..351 CDD:381676 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.