DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf9

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_067704.1 Gene:Gdf9 / 59304 RGDID:71038 Length:440 Species:Rattus norvegicus


Alignment Length:311 Identity:68/311 - (21%)
Similarity:112/311 - (36%) Gaps:78/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 LNQSNKNSSQ---QLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNK 496
            ||.|..:||.   ...|.|.:.:|::   |.|.|    ....|...:.:|||.|||..::..:..
  Rat   162 LNNSAASSSTVTCVCDLVVKEPMSSS---KATPR----APYSFTLRKHRWIEMDVTSLLQPLVAS 219

  Fly   497 SHE--NLGIEIQCDKCKSIGARILSDFSP---------STPPRSTASSDEHLNLMPVLNIIG--- 547
            |..  :|.:...|.:          |.:|         |.||          :|:..||...   
  Rat   220 SERSIHLSVNFTCTR----------DQAPENGTFNMPLSVPP----------SLILYLNDTSTQA 264

  Fly   548 -------HGTLNSQQHGDAD------IHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQ 599
                   ..|....||...|      :.:......||.:  |.|.....:....|.....:.|.:
  Rat   265 YHSWQSLQSTQRHSQHPGQDSVTTRPVEEEATEVERSPR--HRRGQKTLSSETKKPLTASFNLSE 327

  Fly   600 ----------RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP--PRH---NPAHHHALLQS 649
                      .|..:...::|..:|...:|:.|..::..||.|.||  .||   :|.  |.::|:
  Rat   328 YFRQFLFPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPV--HTMVQN 390

  Fly   650 LIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            :|:::.....|||.|.|.|...|.:|.::.:.|  :....:.||....|.|
  Rat   391 IIYEKLDPSVPRPSCVPGKYSPLSVLTIEPDGS--IAYKEYEDMIATRCTC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/68 (25%)
TGF_beta 599..700 CDD:278448 28/115 (24%)
Gdf9NP_067704.1 TGF_beta 337..439 CDD:278448 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.