DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp15

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:256 Identity:48/256 - (18%)
Similarity:88/256 - (34%) Gaps:79/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 WIEFDVTKAVRS--WLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVL 543
            |.|.::|..::.  |..|....|.:...|.:.|                                
  Rat   178 WREMNITHCIQQKLWNRKGRRVLRLRFMCQQQK-------------------------------- 210

  Fly   544 NIIGHGTLNSQQHG--DADIHQIML----TNNRSDQYVHHRSNHDSTWR---------------- 586
               |:.||..:.||  ..|:..::|    |:..:...:..|...:.|.|                
  Rat   211 ---GNETLELRWHGMTSLDVAFLLLYFDDTDESAQAKLLARGQEELTDRESPFLMRSVRQTCSIA 272

  Fly   587 ---------KDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHN 639
                     :|:..||      :|..:...|:|..:....:|:.|:::...||.|.|.   |...
  Rat   273 SDVPCPSQEQDRSVNN------QCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTGVLPYGL 331

  Fly   640 PAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .:.:||::|||:.:..::..|:..|.|.|...:.||.::.|.|  :....:..|....|.|
  Rat   332 NSPNHAIIQSLVNELVNRSVPQLSCVPYKFLPMSILLIEANGS--ILYKEYEGMIAQSCTC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 6/26 (23%)
TGF_beta 599..700 CDD:278448 25/103 (24%)
Bmp15NP_067702.1 TGF_beta 288..390 CDD:278448 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.