DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and tgfb1b

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_692338.3 Gene:tgfb1b / 563884 ZFINID:ZDB-GENE-091028-1 Length:379 Species:Danio rerio


Alignment Length:426 Identity:85/426 - (19%)
Similarity:152/426 - (35%) Gaps:120/426 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 LRHRRSLKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLL 395
            :::.|:|...|.|:....|.:.. :.:||:     ||....|....:.. ..:.|:.....|:.:
Zfish    17 VQYSRALSTCNPLDLELIKRKRI-EAIRGQ-----ILSKLRLPKEPEVE-EKELIENIPAELISV 74

  Fly   396 YSSSLATNFRRGPGSRKNKISQISGNDNIERHC----------------NFGDV----------- 433
            |:|::..|..:.....::.|...:..:...:..                |..|:           
Zfish    75 YNSTMELNEEQAANPVQHTIEDPTEEEYYAKEIHKFTMMEEKPEKYLVFNITDIKHKLGANHVLY 139

  Fly   434 ------NLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRS 492
                  .:.:.....|:| .|::|| ::.|:.|.:.||.|..      :|..:|:.||||..::.
Zfish   140 QAEFRLRIKEPKMGDSEQ-RLELYQ-VTGNKSRYLNSRFISL------QTAGKWVSFDVTSTLKD 196

  Fly   493 WLNKSHENLGIEIQ--CDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQ 555
            ||....|....::|  | .||                      .|..|...:..|.|    .|:.
Zfish   197 WLQMPEEKQEFQLQLAC-SCK----------------------PESQNTEFLFKIAG----LSRN 234

  Fly   556 HGDADIHQIMLTNNRSDQYV----HHRSNHD--STWRKDKWTNNCYKLHQRCCRNQLDVAFKSIK 614
            .||..    :|.:..:..|:    |....|.  .:.||.:....|.:..:.||...|.:.|:...
Zfish   235 RGDTG----LLADQVAKPYILVMSHPADGHSPAKSRRKRETDAVCTEKSEGCCVRSLYIDFRKDL 295

  Fly   615 GFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHK--------------RAPRPCCT 665
            |:::|.:|..:.|.||.|.|              |.:|..::|              .:.:|||.
Zfish   296 GWKWIHEPSGYYANYCTGSC--------------SYVWTSENKYSQVLALYRHHNPGASAQPCCV 346

  Fly   666 PSKLEMLEIL-HVDENHSDKLKISTWSDMQVVECAC 700
            |..|:.|.|: :|...|    |:...|:|.|..|.|
Zfish   347 PQVLDPLPIIYYVGRQH----KVEQLSNMIVKTCKC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 19/63 (30%)
TGF_beta 599..700 CDD:278448 29/115 (25%)
tgfb1bXP_692338.3 TGFb_propeptide 22..253 CDD:279078 49/276 (18%)
TGF_beta 280..378 CDD:278448 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.