DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp8a

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001038436.1 Gene:bmp8a / 561963 ZFINID:ZDB-GENE-030912-13 Length:433 Species:Danio rerio


Alignment Length:284 Identity:69/284 - (24%)
Similarity:111/284 - (39%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 LTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEI 505
            |.:.||::|...|.|:     :..:.:..|..|       |:.||||.|...||.....||||.:
Zfish   197 LHISVYEILREKRHREPELVLLDMQSVPAGQEG-------WLAFDVTSASNRWLLHPRSNLGIRL 254

  Fly   506 QCDKCKS-------IGAR--------ILSDF----SPSTPPRSTASSDEHLNLMPVLNIIGHGTL 551
            ..:..:.       :|.|        :::.|    :|..|||:.    :|.|             
Zfish   255 YVETEEDHRSWVGLVGRRGPRSKQPFMVTFFRASQAPCRPPRAL----KHTN------------- 302

  Fly   552 NSQQHGDADIHQIMLTNNRS--DQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIK 614
               |......:.:...|...  ||      ||.|.             .|.|.:::|.|:|..:.
Zfish   303 ---QRKKKTKYDLPHPNRPGIFDQ------NHSSG-------------RQACKKHELYVSFSDLG 345

  Fly   615 GFEFILQPKVFDAGYCHGRCP-PRHN--PAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILH 676
            ..:::|.|..:.|.||.|.|. |..:  .|.:||::|.|:........|:.||.|:||..:.:|.
Zfish   346 WKDWVLAPTGYSAYYCDGECDYPLGSCMNATNHAMIQLLVHLLRPDEVPKACCAPTKLSPIAVLF 410

  Fly   677 VDENHSDKLKISTWSDMQVVECAC 700
            .|:|::..||  ...:|.|..|.|
Zfish   411 YDDNNNVILK--KQRNMVVKNCGC 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 20/64 (31%)
TGF_beta 599..700 CDD:278448 32/103 (31%)
bmp8aNP_001038436.1 TGFb_propeptide 46..284 CDD:279078 22/93 (24%)
TGFB 332..432 CDD:214556 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.