DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and tgfb5

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_021336789.1 Gene:tgfb5 / 559723 ZFINID:ZDB-GENE-130425-3 Length:414 Species:Danio rerio


Alignment Length:418 Identity:91/418 - (21%)
Similarity:152/418 - (36%) Gaps:115/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 NGFNDISNKRLRHRRS------------LKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFPLT 373
            |...::..:|.||..:            .|::.|:|..|.: .:...:..|.|.....::.|.:|
Zfish    73 NSTKELLKERARHAEAACERESSEEDYYAKEVQRVNMMPLR-TDTNSISPGPQSPYFRIVGFDVT 136

  Fly   374 NAQDANFHHDKIDEANVRLMLLYSSSLA-TNFR--RGPGSRKNKISQISGNDNIERHCNFGDVNL 435
            |.           |.|       ||:|. ..||  |.|..:.....|                  
Zfish   137 NV-----------ERN-------SSTLVKAEFRIFRAPNPQARATEQ------------------ 165

  Fly   436 NQSNKNSSQQLTLKVYQLL-----SANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLN 495
                       .:::||:|     :|..:|.|.||.:|      ...:..|:..|||:.|:.|:.
Zfish   166 -----------RVEIYQILKSEDVTAPSQRYIDSRTVE------PRAKGAWLSVDVTETVKEWMA 213

  Fly   496 KSHENLG--IEIQCDKCKSIGARILSDFSPST----PPRST------ASSDEHLNLMPVLNIIGH 548
            ....|||  |.:.|..|         .|.|||    |.:|.      |..|:.|    :......
Zfish   214 FRERNLGLKISVHCPCC---------TFVPSTNNIVPNKSEELEARFAGIDDDL----IKQTRKP 265

  Fly   549 GTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKW------TNNCYKLHQRCCRNQLD 607
            |....|.........::||...:|:.       ||..:|.:.      |:.|.:..|.||...|.
Zfish   266 GVTKGQIEFSTKTPHLILTLLPTDRL-------DSPIKKTRKKRSAADTSICTRNDQGCCLRSLY 323

  Fly   608 VAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEML 672
            :.|:....:::|.:||.:.|.:|.|.||...:..:|:.::..|..:.:.:.:..|||.|..||.|
Zfish   324 IDFRRDLNWKWIHEPKGYKANFCAGNCPYLWSADNHYNMILPLYNKMNPEASASPCCVPQDLEPL 388

  Fly   673 EILHVDENHSDKLKISTWSDMQVVECAC 700
            .|::.   .....::...|:|.|..|.|
Zfish   389 TIVYF---LGRTPRVEQLSNMVVRSCKC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 19/70 (27%)
TGF_beta 599..700 CDD:278448 27/100 (27%)
tgfb5XP_021336789.1 TGFb_propeptide 21..229 CDD:307025 43/209 (21%)
TGF_beta 317..413 CDD:306518 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.