DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and inhbab

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001018166.1 Gene:inhbab / 553816 ZFINID:ZDB-GENE-050525-2 Length:405 Species:Danio rerio


Alignment Length:335 Identity:71/335 - (21%)
Similarity:119/335 - (35%) Gaps:106/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 IDEANVRLMLLYSSSLATNFRRGPGSR-KNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTL 448
            :::|||.|.|          :...||| |.|:|                |.|.|:.|..|.....
Zfish   159 VEQANVWLFL----------KVAKGSRVKGKVS----------------VQLLQNGKADSGSTDR 197

  Fly   449 KVYQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSI 513
            ...|::|   .:.|.:|            |:.|....|.:.|::.|:.....|.:.:.|..|...
Zfish   198 PEDQVVS---EKTIDTR------------RSGWHTLPVPRTVQTLLDGDSSLLSLRVSCPMCAEA 247

  Fly   514 GARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQ--IMLTNNRSDQYVH 576
            ||                        :|:| :...|....::.   ..|:  :|:....::::.|
Zfish   248 GA------------------------VPIL-VPAEGNKVKERE---QSHRPFLMVVLKPAEEHQH 284

  Fly   577 HRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPR---- 637
            .||         |....|....:.||:.|..|.||.|...::|:.|..:.|.||.|.||..    
Zfish   285 RRS---------KRGLECDGKIRVCCKRQFYVNFKDIGWSDWIIAPSGYHANYCEGDCPSHVASI 340

  Fly   638 -------HNPAHHHALLQSLIWQEDHKRAP----RPCCTPSKLEMLEILHVDENHSDKLKISTWS 691
                   |:...:|..::..        :|    :.||.|::|..:.:|:.  |...|:......
Zfish   341 TGSALSFHSTVINHYRMRGY--------SPFNNIKSCCVPTRLRAMSMLYY--NEEQKIIKKDIQ 395

  Fly   692 DMQVVECACS 701
            :|.|.||.||
Zfish   396 NMIVDECGCS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 11/63 (17%)
TGF_beta 599..700 CDD:278448 29/115 (25%)
inhbabNP_001018166.1 TGFb_propeptide 64..272 CDD:279078 34/181 (19%)
TGF_beta 298..404 CDD:278448 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.