DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001103141.1 Gene:Gdf3 / 500311 RGDID:1564178 Length:366 Species:Rattus norvegicus


Alignment Length:231 Identity:55/231 - (23%)
Similarity:96/231 - (41%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 IEFDVTKAVRSWLNKSHENLGIEIQC----DKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPV 542
            ::|::...|:.|.....:||.:.::.    |:...:.|::       ..|.:......|.:|:.|
  Rat   180 LQFNLQGVVKDWNRHQLKNLDLYLEILVKEDRYSRVNAQL-------DNPCNQLMHSLHASLLVV 237

  Fly   543 LNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWT-----NNCYKLHQRCC 602
                   |||.                   ::.|..|      ||.:..     ..|..|   |.
  Rat   238 -------TLNL-------------------KHCHPSS------RKKRAAIPIPKGLCRNL---CH 267

  Fly   603 RNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCC 664
            |:||.|.|:.:...::::.||.|.|.||||.||   ..:..:.::|.:|:|:...| .|.|:..|
  Rat   268 RHQLFVNFQDLGWHKWVIAPKGFMANYCHGDCPFTMTTYLNSSNYAFMQALMHMAD-PRVPKAVC 331

  Fly   665 TPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .|:||..:.:|:.|...:..|:  .:.||.|.||.|
  Rat   332 IPTKLSPISMLYQDNEKNVILR--HYEDMVVDECGC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 5/23 (22%)
TGF_beta 599..700 CDD:278448 34/103 (33%)
Gdf3NP_001103141.1 TGFB 266..366 CDD:214556 35/103 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.