DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and gdf9

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001012383.1 Gene:gdf9 / 497643 ZFINID:ZDB-GENE-050221-7 Length:418 Species:Danio rerio


Alignment Length:375 Identity:82/375 - (21%)
Similarity:147/375 - (39%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 HHDKIDEANVRLM-LLYSSSLATNFRRGPGSRKNKISQI--SGNDNIERHCNFGDVNLNQS-NKN 441
            |..|.|...||.| .||..| :..:|....|.....:::  ...:.::::..|...:::.| |:.
Zfish    69 HRTKPDSRYVRYMRRLYKQS-SKPYRSPEASHLYNTARLITPREECLKQNREFFMQDISYSLNRV 132

  Fly   442 SSQQLTLKVYQLLSAN---------------RRRKITSRKIEFGNVGFQET--------RTQWIE 483
            .||:..||...|.|.:               :.:|.:..::...::|.|.:        ..:|:|
Zfish   133 RSQEHLLKSVLLYSFDHNHLSPFSLLCYLDMKEQKSSKDQMCSNHLGIQHSVPLLSFRVHHRWVE 197

  Fly   484 FDVTKAVRSWL--NKSHENLGIEIQC--DKCKSIGARILS---DFSPSTPPRSTASSDEHLNLMP 541
            .|||..:...:  :|...:|.|.:.|  |.....|.:|..   :.:|.:|           :|:.
Zfish   198 VDVTSFLHPLIQAHKKDIHLLINLTCVEDMISRPGGQIHKSPVELTPRSP-----------SLLL 251

  Fly   542 VLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTW----RKDKWT-----NNCYKL 597
            .||....   .:.|........:.||:|       |.....:.|    |:.:.|     .:..||
Zfish   252 YLNDTSE---VAYQRRSTQGRMVDLTSN-------HWDGKSTLWELTSRRRRGTLKSSETSMPKL 306

  Fly   598 -------HQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPR-----HNPAHHHALLQSL 650
                   ...|......|:||.:|...:|::||.::..||.|.||..     .:|.  |.::|:|
Zfish   307 VPMYEFTTDDCDLYDFRVSFKELKLDHWIIEPKKYNPRYCKGSCPRNVGFMYGSPM--HTMVQNL 369

  Fly   651 IWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |:::.....|||.|.||:...|.:|..:.:.|...|  .:.:|...:|||
Zfish   370 IYEKLDSSVPRPTCVPSEYNPLSVLTFENDKSYAYK--EYEEMIATKCAC 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/88 (19%)
TGF_beta 599..700 CDD:278448 30/105 (29%)
gdf9NP_001012383.1 TGF_beta 317..417 CDD:278448 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.