DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and NODAL

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_060525.3 Gene:NODAL / 4838 HGNCID:7865 Length:347 Species:Homo sapiens


Alignment Length:235 Identity:59/235 - (25%)
Similarity:91/235 - (38%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 DVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDF--SPSTPPRSTASSDEHLNLMPVLNIIG 547
            :||:.:..||  .|.. .:|.|.       :|:..:.  .|.|||.:......:.||......:|
Human   154 EVTRPLSKWL--KHPG-ALEKQM-------SRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLG 208

  Fly   548 HGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKD------KWTNNCYKLH-----QRC 601
            ..||..:.                          :|:||..      :|.....:.|     |.|
Human   209 GSTLLWEA--------------------------ESSWRAQEGQLSWEWGKRHRRHHLPDRSQLC 247

  Fly   602 CRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPA----H--HHALLQSLIWQEDHKRAP 660
            .:.:..|.|..|....:|:.||.::|..|.|.||   ||.    |  :||.:|||:.:....|.|
Human   248 RKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECP---NPVGEEFHPTNHAYIQSLLKRYQPHRVP 309

  Fly   661 RPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ..||.|.|.:.|.:|:||   :.::.:....||.|.||.|
Human   310 STCCAPVKTKPLSMLYVD---NGRVLLDHHKDMIVEECGC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 6/20 (30%)
TGF_beta 599..700 CDD:278448 36/106 (34%)
NODALNP_060525.3 TGFb_propeptide 29..166 CDD:279078 4/13 (31%)
TGFB 247..346 CDD:214556 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.