DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and scw

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:410 Identity:97/410 - (23%)
Similarity:165/410 - (40%) Gaps:114/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 FNDISNKR-------LRHRRSLKKINRLNQNPKKHQNYGDLLRGEQDTMNILLHFPLTNAQDANF 380
            :|:||..:       .||:|||.               .|:|...:|...|              
  Fly    72 YNEISEDQEPKEVLHQRHKRSLD---------------DDILISNEDRQEI-------------- 107

  Fly   381 HHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNF--GDVNLNQSNKNSS 443
                   |:...:|.:||.|             |..|:  ::.::.|..|  .||.::.    |.
  Fly   108 -------ASCNSILTFSSRL-------------KPEQL--DNELDMHITFNTNDVPVDL----SL 146

  Fly   444 QQLTLKVYQLLS-ANRRRKIT---SRKIE---------FGNVGFQETRTQWIEFDVTKAVRSWLN 495
            .|..|::|:..| .:||...|   .||::         .|:|....::..|:||::|..:|.||:
  Fly   147 VQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLH 211

  Fly   496 KSHENLGIEIQCDKCKSIGARILSDFSPS--TPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGD 558
                |.|::.:.:...|||...||.|:..  ||..|..|      |.|.  |:|:      .:|.
  Fly   212 ----NKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTS------LEPF--IVGY------FNGP 258

  Fly   559 ADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPK 623
            ..:.:|.....:.| ....|:...|.........:.|:..|.|.|....|.||.:....:::.||
  Fly   259 ELLVKIQKLRFKRD-LEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPK 322

  Fly   624 VFDAGYCHGRCPPRHNP------AHHHALLQSLI-WQEDHKRAPRPCCTPSKLEMLEIL-HVDEN 680
            .|:|.:|.|.|   :.|      |.:||::|:|: .::.|  .|:|||.|:.|..:.|| :::| 
  Fly   323 KFEAYFCGGGC---NFPLGTKMNATNHAIVQTLMHLKQPH--LPKPCCVPTVLGAITILRYLNE- 381

  Fly   681 HSDKLKISTWSDMQVVECAC 700
              |.:.::.:......||.|
  Fly   382 --DIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 21/76 (28%)
TGF_beta 599..700 CDD:278448 32/108 (30%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 57/248 (23%)
TGFB 300..400 CDD:214556 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.