DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and gdf11

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_998140.1 Gene:gdf11 / 406247 ZFINID:ZDB-GENE-040427-2 Length:390 Species:Danio rerio


Alignment Length:265 Identity:65/265 - (24%)
Similarity:103/265 - (38%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 TLKVY-QLL-------SANRRRKITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGI 503
            |..|| |:|       ..:|..:|.|.|||     .......|...|....:::|..:.|.|.||
Zfish   181 TSTVYLQILRLKPITEQGSRHIRIRSLKIE-----LDSQAGHWQSIDFKHVLQNWFKQPHTNWGI 240

  Fly   504 EIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTN 568
            :|.                         :.||..|.:.|.: :|.|....|...:.   :|:.|.
Zfish   241 DIN-------------------------AYDESGNDLAVTS-LGPGEEGLQPFLEV---KILETT 276

  Fly   569 NRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGR 633
            .||.:.:....:..||             ..||||..|.|.|::. |:::|:.||.:.|.||.|:
Zfish   277 KRSRRNLGLDCDEHST-------------ESRCCRYPLTVDFEAF-GWDWIIAPKRYKANYCSGQ 327

  Fly   634 CPPRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKI--STWSDMQVV 696
            |.......:.|.   .|:...:.:.:..|||||:|:..:.:|:    .:||.:|  .....|.|.
Zfish   328 CEYMFMQKYPHT---HLVQHANPRGSAGPCCTPTKMSPINMLY----FNDKQQIIHGKIPGMVVD 385

  Fly   697 ECACS 701
            .|.||
Zfish   386 RCGCS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/66 (27%)
TGF_beta 599..700 CDD:278448 31/102 (30%)
gdf11NP_998140.1 TGFb_propeptide 52..268 CDD:279078 26/117 (22%)
TGFB 296..390 CDD:214556 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.