DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp7.1

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_989197.1 Gene:bmp7.1 / 394805 XenbaseID:XB-GENE-486014 Length:424 Species:Xenopus tropicalis


Alignment Length:481 Identity:99/481 - (20%)
Similarity:167/481 - (34%) Gaps:169/481 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 ASFTRDLHFLSITTNGFNDISN----KRLR--HRRSLKK----INRLNQNPKKH----QN----- 352
            |.||.|           |::.:    :|||  .||.:::    |..|...|:.|    ||     
 Frog    25 ADFTLD-----------NEVHSSFIQRRLRGQERREMQREILSILGLPHRPRPHLYGKQNSAPMF 78

  Fly   353 ----YGDLLRGEQDTMNILLHF---------PLTNAQDANF--------------HHDK------ 384
                |..:...|::.......:         ||.:.||:||              .|||      
 Frog    79 MLDLYNAMTVDEEEAEGFSYPYKPIFTTQGPPLASQQDSNFLNDADMVMSFVNLVEHDKEFFHQR 143

  Fly   385 ------------------IDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFG 431
                              :..|..|   :|...:...|       :|:..|||            
 Frog   144 RHHREFRFDIAKIPEGEAVTAAEFR---IYKDYIRERF-------ENETFQIS------------ 186

  Fly   432 DVNLNQSNKNSSQQLTLKVYQLLSANRRR-----KITSRKIEFGNVGFQETRTQWIEFDVTKAVR 491
                              |||:|..::.|     ::.||.|.....|       |:.||:|....
 Frog   187 ------------------VYQVLQEHQGRDSDLYELDSRTIWAAEEG-------WLVFDITTTSN 226

  Fly   492 SWLNKSHENLGIEIQCDKC--KSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQ 554
            .|:.....|||:::..:..  :||..::......:.|         | |..|.:......|    
 Frog   227 HWVVNPQHNLGLQLSVESIDGQSINPKMAGLIGTNGP---------H-NKQPFMVAFFKAT---- 277

  Fly   555 QHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDK-------WTNNCYKLHQRCCRNQLDVAFKS 612
                 :||   |.:.||....|...|.....:..:       ..|:.....|.|.:::|.|:||.
 Frog   278 -----EIH---LRSIRSAGGKHRNQNRSKAPKSQEALRVSNIAENSSTDQKQACKKHELYVSFKD 334

  Fly   613 IKGFEFILQPKVFDAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEI 674
            :...::|:.|:.:.|.||.|.|....|.   |.:||::|:|:...:....|:|||.|::|..:.:
 Frog   335 LGWQDWIIAPEGYAAFYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNPISV 399

  Fly   675 LHVDENHSDKLKISTWSDMQVVECAC 700
            |:.|:  |..:.:..:.:|.|..|.|
 Frog   400 LYFDD--SSNVILKKYRNMVVRACGC 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 17/68 (25%)
TGF_beta 599..700 CDD:278448 31/103 (30%)
bmp7.1NP_989197.1 TGFb_propeptide 31..273 CDD:366248 54/298 (18%)
TGF_beta_BMP7 318..424 CDD:381667 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.