DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp5

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_957345.1 Gene:bmp5 / 394026 ZFINID:ZDB-GENE-040426-1413 Length:446 Species:Danio rerio


Alignment Length:355 Identity:77/355 - (21%)
Similarity:146/355 - (41%) Gaps:66/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNI----------E 425
            ||.||.|.||.:| .|.....:.|:......::.||.....:..::||...:.:          :
Zfish   132 PLANAHDTNFLND-ADMVMSFVNLVERDKDFSHHRRHYREFRFDLTQIPEGEAVTAAEFRIYKDQ 195

  Fly   426 RHCNFGDVNLNQSNKNSSQQLTLKV--YQLLSANRRRKITSRKIEFGNVGFQETRTQWIEFDVTK 488
            .|..:             :.:||||  ||::.....|...:..:::..:  :.|...|:.||:|.
Zfish   196 SHIRY-------------ENITLKVTIYQVIKEYPNRDPDTFLLDWKKI--RATDGGWLVFDITA 245

  Fly   489 AVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNS 553
            ....|:....:|:|:::..:               :|..||       :| |....|||.....|
Zfish   246 TSNHWVLNPQQNMGLQLCVE---------------TTDGRS-------IN-MKSAGIIGRNGPQS 287

  Fly   554 QQ--------HGDADIHQIMLTNNRSDQYVHHRSNHD--STWRKDKWTNNCYKLHQRCCRNQLDV 608
            :|        ..:..:..:..|.::...:..::|...  ||........|..:..|.|.:::|.|
Zfish   288 KQPFLVAFFKASEVLLRSVRATGSKKKSHNRNKSKTQVKSTPALKSGDQNTSEQRQACKKHELYV 352

  Fly   609 AFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLE 670
            :|:.:...::|:.|:.:.|.||.|.|.   ..|..|.:||::|:|:........|:|||.|:||.
Zfish   353 SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDNVPKPCCAPTKLN 417

  Fly   671 MLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .:.:|:.|:  |..:.:..:.:|.|..|.|
Zfish   418 AISVLYFDD--SSNVILKKYRNMVVRSCGC 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/65 (23%)
TGF_beta 599..700 CDD:278448 31/103 (30%)
bmp5NP_957345.1 TGFb_propeptide 23..295 CDD:279078 40/201 (20%)
TGF_beta 343..445 CDD:278448 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.