DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF6

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001001557.1 Gene:GDF6 / 392255 HGNCID:4221 Length:455 Species:Homo sapiens


Alignment Length:108 Identity:36/108 - (33%)
Similarity:56/108 - (51%) Gaps:5/108 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 KLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC--PPR-HNPAHHHALLQSLIWQEDHK 657
            |...||.:..|.|.||.:...::|:.|..::|.:|.|.|  |.| |....:||::|:|:...|..
Human   349 KSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPG 413

  Fly   658 RAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ..|..||.|:||..:.||::|..::...|  .:.||.|..|.|
Human   414 STPPSCCVPTKLTPISILYIDAGNNVVYK--QYEDMVVESCGC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 34/103 (33%)
GDF6NP_001001557.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..93
TGFb_propeptide 79..281 CDD:395559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..351 1/1 (100%)
TGF_beta_GDF5_6_7 354..455 CDD:381644 34/103 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.