DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and INHBB

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_002184.2 Gene:INHBB / 3625 HGNCID:6067 Length:407 Species:Homo sapiens


Alignment Length:299 Identity:68/299 - (22%)
Similarity:113/299 - (37%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 NQSNKN-----SSQQLTLKVY-QLLSANRRRKITSRKIEFGNVGFQE----------------TR 478
            |:.|:|     :|..|.||:. .:|....|||:..:      |.|||                .|
Human   165 NEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVK------VYFQEQGHGDRWNMVEKRVDLKR 223

  Fly   479 TQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVL 543
            :.|..|.:|:|:::...:....|.:::|||.|                        :.|.::||.
Human   224 SGWHTFPLTEAIQALFERGERRLNLDVQCDSC------------------------QELAVVPVF 264

  Fly   544 NIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRK-----DKWTNNCYKLHQRCCR 603
            ...|     .:.|....:.|..|.::|      ||.      ||     |..||       .|||
Human   265 VDPG-----EESHRPFVVVQARLGDSR------HRI------RKRGLECDGRTN-------LCCR 305

  Fly   604 NQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP------PRHNPAHHHALLQSLIWQEDHKRAPRP 662
            .|..:.|:.|...::|:.|..:...||.|.||      |....:.|.|::.....:..:......
Human   306 QQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNS 370

  Fly   663 CCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ||.|:||..:.:|:.|:.::  :......:|.|.||.|:
Human   371 CCIPTKLSTMSMLYFDDEYN--IVKRDVPNMIVEECGCA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 18/80 (23%)
TGF_beta 599..700 CDD:278448 27/106 (25%)
INHBBNP_002184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..62
TGFb_propeptide 57..278 CDD:279078 30/147 (20%)
TGFB 303..406 CDD:214556 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.