DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and INHA

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_002182.1 Gene:INHA / 3623 HGNCID:6065 Length:366 Species:Homo sapiens


Alignment Length:444 Identity:90/444 - (20%)
Similarity:145/444 - (32%) Gaps:140/444 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 LHFLSITTNGFNDISNKRLRHRRSLKKINRL-------------------NQNPKKHQNYGDLLR 358
            |.||.:|..|.:......|.....|.|:..|                   .:.|::|...|...|
Human     6 LLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHR 70

  Fly   359 G-----EQDTMNILLHFPLTNA--QDANFHHDKIDEANVRLM-LLYSSSLATNFRRGPGSRKNKI 415
            |     |:|....:| ||.|:|  :|.:.......||...|. .::..|..|.      ||:...
Human    71 GSEPEEEEDVSQAIL-FPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTR------SRQVTS 128

  Fly   416 SQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRTQ 480
            :|:..:..::|.        ..:..|||:.|    ..||:.:....: :..:..|:     ....
Human   129 AQLWFHTGLDRQ--------GTAASNSSEPL----LGLLALSPGGPV-AVPMSLGH-----APPH 175

  Fly   481 WIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNI 545
            |....:..:..|.|  :|..|.:.::|..|           :.|..|.:|          |.|  
Human   176 WAVLHLATSALSLL--THPVLVLLLRCPLC-----------TCSARPEAT----------PFL-- 215

  Fly   546 IGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKL----------HQR 600
            :.|........|:.                ..||....:|   .|:.:..:|          |..
Human   216 VAHTRTRPPSGGER----------------ARRSTPLMSW---PWSPSALRLLQRPPEEPAAHAN 261

  Fly   601 CCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC----PPR---------HNPAHHHALLQSLIW 652
            |.|..|:::|:.:....:|:.|..|...||||.|    ||.         ..||..::||.    
Human   262 CHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLP---- 322

  Fly   653 QEDHKRAPRPCCT--PSKLEMLEILHV----DENHSDKLKISTWSDMQVVECAC 700
                  ..:|||.  |..:..   |||    |..:|  .|..|..::....|||
Human   323 ------GAQPCCAALPGTMRP---LHVRTTSDGGYS--FKYETVPNLLTQHCAC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 11/63 (17%)
TGF_beta 599..700 CDD:278448 30/119 (25%)
INHANP_002182.1 TGFB 262..366 CDD:214556 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.