DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and tgfb1a

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_878293.1 Gene:tgfb1a / 359834 ZFINID:ZDB-GENE-030618-1 Length:377 Species:Danio rerio


Alignment Length:378 Identity:92/378 - (24%)
Similarity:156/378 - (41%) Gaps:100/378 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFG-DVN 434
            |.:.|.|..   .||.::   |:.||:|::..:     ...|.||..:...|  |.:  || :|:
Zfish    53 PESGADDDG---QKIPDS---LLSLYNSTVELS-----EEMKTKIVPVQDED--EDY--FGKEVH 102

  Fly   435 ---LNQSNKNSSQQLTLKV---------YQLLS-ANRRRKITS------RKIE-FGNVGFQ---- 475
               ..|:..|:..|:...|         |:||| |..|.:|.:      :::| :..||.|    
Zfish   103 KFVFQQAQNNTKHQMFFNVSEMKRSIPDYRLLSQAELRLRIKNPTMDQEQRLELYRGVGDQARYL 167

  Fly   476 -------ETRTQWIEFDVTKAVRSWL--NKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTA 531
                   :...:|:.|||.:.:..||  ::..|.|.:.:.|| ||:                :..
Zfish   168 GTRFVSKDLSNRWLSFDVKQTMIEWLQGSEDEETLELRLYCD-CKA----------------NQQ 215

  Fly   532 SSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIML----------TNNRSDQYVHHRS--NHDST 584
            |:|:.|     ..|.|   |:.|:...|.:..:|:          :|..|...|..|.  ..|.|
Zfish   216 STDKFL-----FTISG---LDKQRGDTAGLADMMVKPYILALSLPSNGNSLASVRKRRAVGTDET 272

  Fly   585 WRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQS 649
                     |.:..:.||..:|.:.|:...|:::|.:||.:.|.||.|.|....|..:.::.:.:
Zfish   273 ---------CDEKTETCCMRKLYIDFRKDLGWKWIHKPKGYFANYCMGSCTYIWNAENKYSQILA 328

  Fly   650 LIWQEDHKRAPRPCCTPSKLEMLEIL-HVDENHSDKLKISTWSDMQVVECACS 701
            |....:...:.:|||.|:.|:.|.|| :|...|    |:...|:|.|..|.||
Zfish   329 LYKHHNPGASAQPCCVPAILDPLPILYYVGRQH----KVEQLSNMVVRNCKCS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 21/93 (23%)
TGF_beta 599..700 CDD:278448 30/101 (30%)
tgfb1aNP_878293.1 TGFb_propeptide 20..248 CDD:366248 53/234 (23%)
TGF_beta_TGFB1 280..377 CDD:381654 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.