DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and BMP8A

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_861525.2 Gene:BMP8A / 353500 HGNCID:21650 Length:402 Species:Homo sapiens


Alignment Length:281 Identity:60/281 - (21%)
Similarity:113/281 - (40%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 SQQLTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLG 502
            ::.|.:.::|::.....|:     :..:.:..|:.|       |:..|||.|...||.|.|::||
Human   158 NRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEG-------WLVLDVTAASDCWLLKRHKDLG 215

  Fly   503 IEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLT 567
            :.:..:                       :.|.|.....:..::|.....|||.......:...:
Human   216 LRLYVE-----------------------TEDGHSVDPGLAGLLGQRAPRSQQPFVVTFFRASPS 257

  Fly   568 NNRSDQYVHHRSNHDSTWRKDKWTNNCYKLH---------------QRCCRNQLDVAFKSIKGFE 617
            ..|:.:.|.....     |:.|.:|...:.:               |.|.|::|.|:|:.:...:
Human   258 PIRTPRAVRPLRR-----RQPKKSNELPQANRLPGIFDDVRGSHGRQVCRRHELYVSFQDLGWLD 317

  Fly   618 FILQPKVFDAGYCHGRCP-PRHN--PAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDE 679
            :::.|:.:.|.||.|.|. |..:  .|.:||:||||:........|:.||.|:||....:|:.|.
Human   318 WVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDS 382

  Fly   680 NHSDKLKISTWSDMQVVECAC 700
              |:.:.:....:|.|..|.|
Human   383 --SNNVILRKHRNMVVKACGC 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 16/67 (24%)
TGF_beta 599..700 CDD:278448 32/103 (31%)
BMP8ANP_861525.2 TGFb_propeptide 33..251 CDD:279078 22/122 (18%)
TGF_beta 299..401 CDD:278448 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.