DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and spaw

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_851298.1 Gene:spaw / 338101 ZFINID:ZDB-GENE-030219-1 Length:404 Species:Danio rerio


Alignment Length:350 Identity:70/350 - (20%)
Similarity:130/350 - (37%) Gaps:114/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 ISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLKVY----------QLLSANRRRKITSRKIEF 469
            :|.:|.:|||:    ..::.:.....::|:::|:.::          .:...|::..:.|.|   
Zfish   104 MSSLSASDNIQ----LSELRIRLPAFSASRRVTVDIFHQHKQHCASDSVFCRNKKLFLGSVK--- 161

  Fly   470 GNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTA--- 531
             :|...::.:.|..|::|:.::.||.:..:                         ||.|.||   
Zfish   162 -SVDVSQSSSSWRVFNITELLQQWLIQGMD-------------------------TPDRVTAPDY 200

  Fly   532 -------SSDEHLNLMPVLNIIGHGTLNSQ-----QHGDADIHQIMLTNNRSDQYVHHRSNHDST 584
                   |.|:.:.           :|.|.     ||..|:  ::|:.....:...|..|:..:|
Zfish   201 DQGSGSGSGDDFIE-----------SLTSSWPRKIQHPTAE--RVMIVVFYKETVTHSASSLMNT 252

  Fly   585 WRKDKWT-------NNCYKLHQR----------------------------CCRNQLDVAFKSIK 614
            ..:.|:.       ....:.|:|                            |.|..:.|.|..|.
Zfish   253 VAQSKYVTLNRPADGTQGRRHKRNRVERMRMTDDRNVTGKPTPSEEQQASLCRRVDMWVDFDQIG 317

  Fly   615 GFEFILQPKVFDAGYCHGRCP----PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEIL 675
            ..|:|:.||.::|..|.|.||    ..:||. :||.:|||:.....:|...|.|.|.:|..|.:|
Zfish   318 WDEWIVHPKRYNAYRCEGECPSPLDETYNPT-NHAYMQSLLKLYQPERVSCPSCVPLRLSSLSML 381

  Fly   676 HVDENHSDKLKISTWSDMQVVECAC 700
            :.:   .|.:.:....||.|.||.|
Zfish   382 YYE---GDGVVMRHHEDMIVEECGC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 11/73 (15%)
TGF_beta 599..700 CDD:278448 35/132 (27%)
spawNP_851298.1 TGFb_propeptide 50..188 CDD:366248 16/91 (18%)
TGF_beta_NODAL 302..404 CDD:381637 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.