DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and bmp7a

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_571396.1 Gene:bmp7a / 30584 ZFINID:ZDB-GENE-000208-25 Length:432 Species:Danio rerio


Alignment Length:468 Identity:101/468 - (21%)
Similarity:174/468 - (37%) Gaps:119/468 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 GNSYFNNFMGASFTRDLHFLSITTNGFNDI----------SNKRLRHRRSLKKINRLNQNPKK-- 349
            |.|...:.|.|:||.|           |||          |.:|...:|.:..|..|.|.|:.  
Zfish    19 GCSVLADAMQANFTMD-----------NDIQSSFIQRRLKSQERREMQREILSILGLPQRPRPLL 72

  Fly   350 HQNYGDLLRGEQDTMNILLHF--------------------PLTNAQDANFHHD---------KI 385
            |:.:........|..|.:|..                    ||...||:.|..|         .:
Zfish    73 HERHTAAPMYMLDLYNAILEDGDRRGGLVYSYEPAYTTPGPPLVTQQDSRFLSDADMVMSFANTV 137

  Fly   386 D-EANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDVNLNQSNKNSSQQLTLK 449
            | |.:::|...:......:..|.|.......::.....:..|            .:..::...:.
Zfish   138 DPEEDLQLYHQHRREFRFDLSRIPPGETVTAAEFRIYKDFVR------------ERYENETFHVS 190

  Fly   450 VYQLLSANRRRK---ITSRKIEFGNVGFQETRTQWIEFDVTKAVRSWLNKSHENLGIEIQCDKCK 511
            |:|:|....||:   :.||.:.....|       |:.||:|.....|:....:|||:::..:  .
Zfish   191 VFQVLQQQHRRELYLLDSRVVWAAEEG-------WLVFDLTVTSNHWVINPGQNLGLQLLVE--T 246

  Fly   512 SIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIG-HGTLNSQQHGDADIHQ--IMLTNNRS-- 571
            |.|||:       .|.|:              .::| .|..|.|....|.:..  |.|.:.||  
Zfish   247 SHGARM-------NPRRA--------------GLVGSSGAQNKQPFMVAFLKASGIHLRSVRSAS 290

  Fly   572 --DQYVHHRSN-------HDSTWRKDKWTNNCYKL--HQRCCRNQLDVAFKSIKGFEFILQPKVF 625
              .|..|||:.       |.....|.........:  .|.|.:::|.|:|:.:...::|:.|:.:
Zfish   291 GGKQKGHHRTKNAKPGAAHSQVALKTAEATEGASIDPKQGCKKHELYVSFRDLGWQDWIIAPEGY 355

  Fly   626 DAGYCHGRCPPRHNP---AHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKI 687
            .|.||.|.|....|.   |.:||::|:|:...:.:..|:|||.|::|..:.:|:.|:  |..:.:
Zfish   356 AAYYCEGECVFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLHGISVLYFDD--SSNVIL 418

  Fly   688 STWSDMQVVECAC 700
            ..:.:|.|..|.|
Zfish   419 KKYRNMVVRACGC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 16/66 (24%)
TGF_beta 599..700 CDD:278448 30/103 (29%)
bmp7aNP_571396.1 TGFb_propeptide 34..275 CDD:279078 53/293 (18%)
TGF_beta 329..431 CDD:278448 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.