DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and ndr2

DIOPT Version :10

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_624359.1 Gene:ndr2 / 30292 ZFINID:ZDB-GENE-990415-181 Length:501 Species:Danio rerio


Alignment Length:112 Identity:36/112 - (32%)
Similarity:54/112 - (48%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 LHQ--RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNP------AHHHALLQSLIWQ 653
            ||:  .|.|..:.|.|..|....:|:.||.::|..|.|.||   ||      ..:||.:|||:..
Zfish   395 LHKSTTCRRVDMHVDFNQIGWGSWIVFPKKYNAYRCEGACP---NPLGEELRPTNHAYMQSLLKY 456

  Fly   654 EDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ....|.|..||.|::...|.:|:.:   :.::.:....||||.||.|
Zfish   457 HHPSRVPASCCAPTRTSALSMLYYE---NGEMILRHHEDMQVEECGC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <438..518 CDD:480997
TGF_beta_maverick 598..700 CDD:381633 34/109 (31%)
ndr2NP_624359.1 TGFb_propeptide 43..>174 CDD:480997
PHA03247 <175..322 CDD:223021
TGF_beta_NODAL 399..500 CDD:381637 33/106 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.