DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and inhbb

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_571143.2 Gene:inhbb / 30275 ZFINID:ZDB-GENE-990415-2 Length:393 Species:Danio rerio


Alignment Length:291 Identity:69/291 - (23%)
Similarity:108/291 - (37%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 NQSNKN-SSQQLTLKVY-----QLLSANRRRKITSRKIEFGNVG------FQETRTQ-----WIE 483
            |:.|:| ...|..|.:|     ..|....|||:|.|...:...|      ..|.|.:     |..
Zfish   149 NEGNQNLYVLQANLWLYFKLMPGTLEKGLRRKVTVRVHSYEPGGQNVHWPMMEKRVELKRSGWHT 213

  Fly   484 FDVTKAVRSWLNKSHENLGIEIQCDKCKSIGA-RILSDFSPSTPPRSTASSDEHLNLMPVLNIIG 547
            |.|::|:|..|.|......::|.|:.|::... .||.|  ||.|..           .|.|    
Zfish   214 FPVSEAIREMLAKGGRRQDLDIHCEGCEAANVLPILVD--PSDPSH-----------RPFL---- 261

  Fly   548 HGTLNSQQHGDAD-IHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFK 611
              .:.:||   || .|:|.......|      .|:...                |||.|..:.|:
Zfish   262 --VVRAQQ---ADGKHRIRKRGLECD------GNNGGL----------------CCRQQFYIDFR 299

  Fly   612 SIKGFEFILQPKVFDAGYCHGRCP------PRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLE 670
            .|...::|:.|..:...||.|.||      |....:.|.|::.....:.....:...||.|:||.
Zfish   300 LIGWNDWIIAPAGYYGNYCEGSCPAYMAGVPGSASSFHTAVVNQYRMRGMSPGSVNSCCIPTKLS 364

  Fly   671 MLEILHVDENHSDKLKISTWSDMQVVECACS 701
            .:.:|:.|:.::  :......:|.|.||.|:
Zfish   365 TMSMLYFDDEYN--IVKRDVPNMIVEECGCA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 19/79 (24%)
TGF_beta 599..700 CDD:278448 27/106 (25%)
inhbbNP_571143.2 TGFb_propeptide 54..263 CDD:279078 33/132 (25%)
TGFB 289..392 CDD:214556 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.