DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf15

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_062089.1 Gene:Gdf15 / 29455 RGDID:2674 Length:303 Species:Rattus norvegicus


Alignment Length:335 Identity:66/335 - (19%)
Similarity:125/335 - (37%) Gaps:81/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 LMLLYS-----SSLATNFRRGPGSRKNKISQISGNDNIERHCNFGD----VNLNQSNKNSSQQLT 447
            |:||.|     .:||.     |..|:: :|:...|.: |....|.|    ::.|||.::|:.:.|
  Rat    25 LLLLLSWPSQGDALAL-----PEQRRS-LSESQLNPD-ELRGRFQDLLSRLHANQSREDSNSEPT 82

  Fly   448 LKVYQLLSANRRRKITSRKIEFGNVG------FQETRTQWI--EFDVTKAV-------RSWLNKS 497
                    .:...:|.|.::..|:.|      .:.:.||.:  .:.|.:|:       |.|....
  Rat    83 --------PDPAVRILSPEVRLGSHGRLLLRVNRASLTQGLPEAYRVHRALLLLTPSSRPWDITR 139

  Fly   498 HENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGTLNSQQHGDADIH 562
            .....|.:|....:::..|:......:..|...|..:.||.     :..|.|             
  Rat   140 PLQRAISLQGPHARALRLRLAPPPDLAVLPSGGARLELHLR-----SAAGRG------------- 186

  Fly   563 QIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCR-NQLDVAFKSIKGFEFILQPKVFD 626
                   |...::|.|             ::|.....|||. ..:....:.:...:::|.|:...
  Rat   187 -------RRSAHLHPR-------------DSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQ 231

  Fly   627 AGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWS 691
            ...|.|.||..:..|:.|||:::.:......|.|.|||.||....:.::|..::   .:.:.|:.
  Rat   232 LSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDS---GVSLQTYD 293

  Fly   692 DMQVVECACS 701
            |:....|.|:
  Rat   294 DLVAQGCHCA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 13/78 (17%)
TGF_beta 599..700 CDD:278448 24/101 (24%)
Gdf15NP_062089.1 TGF_beta 204..302 CDD:278448 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.