DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf11

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_058899.1 Gene:Gdf11 / 29454 RGDID:2673 Length:405 Species:Rattus norvegicus


Alignment Length:252 Identity:62/252 - (24%)
Similarity:94/252 - (37%) Gaps:69/252 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 RRRKITSRKIEFGNVGFQETRT-QWIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDF 521
            |..:|.|.|||.      .:|: .|...|..:.:.||..:...|.||||..             |
  Rat   215 RHIRIRSLKIEL------HSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINA-------------F 260

  Fly   522 SPSTPPRSTASSDEHLNLMPVLNIIGHGT---LNSQQHGDADIHQIM----LTNNRSDQYVHHRS 579
            .||                        ||   :.|...|...:|..|    |.|.:       ||
  Rat   261 DPS------------------------GTDLAVTSLGPGAEGLHPFMELRVLENTK-------RS 294

  Fly   580 NHDSTWRKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHH 644
            ..:.....|:     :....||||..|.|.|::. |:::|:.||.:.|.||.|:|.......:.|
  Rat   295 RRNLGLDCDE-----HSSESRCCRYPLTVDFEAF-GWDWIIAPKRYKANYCSGQCEYMFMQKYPH 353

  Fly   645 ALLQSLIWQEDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            .   .|:.|.:.:.:..|||||:|:..:.:|:.  |...::.......|.|..|.||
  Rat   354 T---HLVQQANPRGSAGPCCTPTKMSPINMLYF--NDKQQIIYGKIPGMVVDRCGCS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/48 (31%)
TGF_beta 599..700 CDD:278448 30/100 (30%)
Gdf11NP_058899.1 TGFb_propeptide 59..283 CDD:307025 24/110 (22%)
TGFB 311..405 CDD:214556 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.