DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Mstn

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_062024.1 Gene:Mstn / 29152 RGDID:3115 Length:376 Species:Rattus norvegicus


Alignment Length:231 Identity:55/231 - (23%)
Similarity:89/231 - (38%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 WIEFDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNI 545
            |...||...:::||.:...||||||          :.|.:.............::.||  |.|.:
  Rat   204 WQSIDVKTVLQNWLKQPESNLGIEI----------KALDENGHDLAVTFPGPGEDGLN--PFLEV 256

  Fly   546 IGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNC--YKLHQRCCRNQLDV 608
                             ::..|..||              |:| :..:|  :....||||..|.|
  Rat   257 -----------------KVTDTPKRS--------------RRD-FGLDCDEHSTESRCCRYPLTV 289

  Fly   609 AFKSIKGFEFILQPKVFDAGYCHGRC--------PPRHNPAHHHALLQSLIWQEDHKRAPRPCCT 665
            .|::. |:::|:.||.:.|.||.|.|        |..|           |:.|.:.:.:..||||
  Rat   290 DFEAF-GWDWIIAPKRYKANYCSGECEFVFLQKYPHTH-----------LVHQANPRGSAGPCCT 342

  Fly   666 PSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            |:|:..:.:|:.  |..:::.......|.|..|.||
  Rat   343 PTKMSPINMLYF--NGKEQIIYGKIPAMVVDRCGCS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 10/24 (42%)
TGF_beta 599..700 CDD:278448 31/108 (29%)
MstnNP_062024.1 TGFb_propeptide 37..250 CDD:413528 12/55 (22%)
TGF_beta_GDF8 269..376 CDD:381658 32/120 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.