DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and BMP10

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_055297.1 Gene:BMP10 / 27302 HGNCID:20869 Length:424 Species:Homo sapiens


Alignment Length:431 Identity:108/431 - (25%)
Similarity:171/431 - (39%) Gaps:101/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 INRLNQNPKKHQN--YGDLLRGEQD--TMNILLH------FPLTNAQDANFHHDKIDEANV---R 391
            |..|.|:|.:...  :||:. .|||  ..|.||.      ....|..|....    |.|.|   .
Human    24 IMNLEQSPLEEDMSLFGDVF-SEQDGVDFNTLLQSMKDEFLKTLNLSDIPTQ----DSAKVDPPE 83

  Fly   392 LMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHCNFGDV-------NLNQSNKNSSQQLTLK 449
            .||...:..||:....|.:  |.|......|...:..:|..:       |::..:........|:
Human    84 YMLELYNKFATDRTSMPSA--NIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEVIMAELR 146

  Fly   450 VYQLLSANRR------RKITSRKI---EFGNVGFQE-----------TRTQWIEFDVTKAVRSWL 494
            :|.|:..:|.      ||||..::   :..|.|.:.           |.::|..||||.|:|.|.
Human   147 LYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRWQ 211

  Fly   495 ---NKSHE-NLGIEIQCDKCKSIGA-RILSDFSP-----------STPPRSTASSDEHLNLM--- 540
               :.:|: .:.||.:.|:.:...: |:..|.|.           |....|.....|.||.|   
Human   212 KSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISH 276

  Fly   541 ---PVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSN--HDSTWRKDKWTNNCYKLHQR 600
               |.|:.:|   |:|...|..:           :..:..|||  :|||.|..:.....|     
Human   277 EQLPELDNLG---LDSFSSGPGE-----------EALLQMRSNIIYDSTARIRRNAKGNY----- 322

  Fly   601 CCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHH-----HALLQSLIWQEDHKRAP 660
            |.|..|.:.||.|....:|:.|..::|..|.|.|  .:..|.|     ||::|:|:..::.::|.
Human   323 CKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVC--NYPLAEHLTPTKHAIIQALVHLKNSQKAS 385

  Fly   661 RPCCTPSKLEMLEILHVDEN-HSDKLKISTWSDMQVVECAC 700
            :.||.|:|||.:.||::|:. .:.|.|   :..|.|.||.|
Human   386 KACCVPTKLEPISILYLDKGVVTYKFK---YEGMAVSECGC 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 22/87 (25%)
TGF_beta 599..700 CDD:278448 34/106 (32%)
BMP10NP_055297.1 TGFb_propeptide 55..256 CDD:279078 42/206 (20%)
TGF_beta 321..423 CDD:278448 35/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.