DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and AMH

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_000470.3 Gene:AMH / 268 HGNCID:464 Length:560 Species:Homo sapiens


Alignment Length:104 Identity:24/104 - (23%)
Similarity:44/104 - (42%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 CCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP-PR--HNPAH-HHALLQSLIWQEDHKRAPR 661
            |...:|.|..::.:.   :|.|:.:.|..|.|.|. |:  .||.: :|.:|...:.......|..
Human   462 CALRELSVDLRAERS---VLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARP 523

  Fly   662 PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            |||.|:......::.:.|   :::......:|...||.|
Human   524 PCCVPTAYAGKLLISLSE---ERISAHHVPNMVATECGC 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 23/102 (23%)
AMHNP_000470.3 AMH_N 77..398 CDD:309721
TGFB 462..560 CDD:214556 24/104 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.