DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and GDF10

DIOPT Version :10

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_004953.1 Gene:GDF10 / 2662 HGNCID:4215 Length:478 Species:Homo sapiens


Alignment Length:125 Identity:44/125 - (35%)
Similarity:61/125 - (48%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 RKDKWTNNCYKLHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALL 647
            |:.:|..     .:.|.|..|.|.|..|...|:|:.||.|||.||.|.|.   |:.....:||.:
Human   366 RRKQWDE-----PRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATI 425

  Fly   648 QSLIWQEDHKRA-------PRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            ||::      ||       |.|||.|.|:..|.:|.:|||.:..||:  :.:|.|..|||
Human   426 QSIV------RAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKV--YPNMSVDTCAC 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <438..518 CDD:480997
TGF_beta_maverick 598..700 CDD:381633 40/111 (36%)
GDF10NP_004953.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..319
TGF_beta_GDF10 367..478 CDD:381664 43/124 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.