DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Bmp6

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_038951315.1 Gene:Bmp6 / 25644 RGDID:2214 Length:535 Species:Rattus norvegicus


Alignment Length:392 Identity:87/392 - (22%)
Similarity:160/392 - (40%) Gaps:111/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNK-----ISQISGND-------N 423
            |||:|||:.|.:|      ..:::.:.:.:..:....|..|.:|     :|||...:       .
  Rat   192 PLTSAQDSAFLND------ADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEAVTAAEFR 250

  Fly   424 IERHCNFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRK-----ITSRKIEFGNVGFQETRTQWIE 483
            :.:.|..|      |.||  |...:.:||:|..::.|.     :.:|.:.....|       |:|
  Rat   251 VYKDCVVG------SFKN--QTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEG-------WLE 300

  Fly   484 FDVTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMP-VLNIIG 547
            ||:|.....|:.....|:|:::      |:..|                  :.|::.| ...::|
  Rat   301 FDITATSNLWVVTPQHNMGLQL------SVVTR------------------DGLHINPRAAGLVG 341

  Fly   548 H-GTLNSQQHGDA-----DIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTN------NCYKLHQR 600
            . |..:.|....|     ::| :..|.:.|.:. ..:|.:.||..:|....      |..:|...
  Rat   342 RDGPYDKQPFMVAFFKVSEVH-VRTTRSASSRR-RQQSRNRSTQSQDVSRGSSASDYNSSELKTA 404

  Fly   601 CCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCP---PRHNPAHHHALLQSLI----W------ 652
            |.:::|.|:|:.:...::|:.||.:.|.||.|.|.   ..|..|.:||::|:|:    |      
  Rat   405 CKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVSALTWLVGPGL 469

  Fly   653 ---------------QEDH----KRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVEC 698
                           ::.|    :..|:|||.|:||..:.:|:.|:|.:..||  .:.:|.|..|
  Rat   470 DPVSFLTVSSHASLLEQVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILK--KYRNMVVRAC 532

  Fly   699 AC 700
            .|
  Rat   533 GC 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 15/68 (22%)
TGF_beta 599..700 CDD:278448 35/132 (27%)
Bmp6XP_038951315.1 TGFb_propeptide 58..355 CDD:395559 41/207 (20%)
TGF_beta_BMP6 404..535 CDD:381666 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.