DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf7

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:XP_006239940.1 Gene:Gdf7 / 252833 RGDID:620105 Length:456 Species:Rattus norvegicus


Alignment Length:104 Identity:34/104 - (32%)
Similarity:55/104 - (52%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRC--PPR-HNPAHHHALLQSLIWQEDHKRAPR 661
            ||.|..|.|.||.:...::|:.|..::|.:|.|.|  |.| |....:||::|:|:.......||.
  Rat   354 RCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPA 418

  Fly   662 PCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECAC 700
            .||.|::|..:.||::|.  ::.:....:.||.|..|.|
  Rat   419 SCCVPARLSPISILYIDA--ANNVVYKQYEDMVVEACGC 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078
TGF_beta 599..700 CDD:278448 33/102 (32%)
Gdf7XP_006239940.1 TGFb_propeptide <87..230 CDD:279078
TGF_beta 358..455 CDD:278448 30/98 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.