DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Gdf15

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001317616.1 Gene:Gdf15 / 23886 MGIID:1346047 Length:303 Species:Mus musculus


Alignment Length:350 Identity:61/350 - (17%)
Similarity:122/350 - (34%) Gaps:111/350 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 LMLLYS-----SSLATNFRR--GPGSRKNKISQISG--NDNIERHCNFGDVNLNQSNKNSSQQLT 447
            |:||.|     .:||...:|  ||.|:.| ..::.|  .|.:.|      ::.|||.::|:.:  
Mouse    25 LLLLLSWPSQGDALAMPEQRPSGPESQLN-ADELRGRFQDLLSR------LHANQSREDSNSE-- 80

  Fly   448 LKVYQLLSANRRRKITSRKIEFGNVG---------------------------FQETRTQWIEFD 485
                  .|.:...:|.|.::..|:.|                           ...|...|   |
Mouse    81 ------PSPDPAVRILSPEVRLGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPW---D 136

  Fly   486 VTKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGHGT 550
            :|:.::.         .:.::..:..::..|:       |||...|       ::|         
Mouse   137 ITRPLKR---------ALSLRGPRAPALRLRL-------TPPPDLA-------MLP--------- 169

  Fly   551 LNSQQHGDADIH---QIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCYKLHQRCCR-NQLDVAFK 611
                 .|...:.   ::.....|...:.|.|             ::|.....|||. ..:....:
Mouse   170 -----SGGTQLELRLRVAAGRGRRSAHAHPR-------------DSCPLGPGRCCHLETVQATLE 216

  Fly   612 SIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPCCTPSKLEMLEILH 676
            .:...:::|.|:......|.|.||..:..|:.||.:::.:......:.|.|||.||....:.::|
Mouse   217 DLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMH 281

  Fly   677 VDENHSDKLKISTWSDMQVVECACS 701
            ..::   .:.:.|:.|:....|.|:
Mouse   282 RTDS---GVSLQTYDDLVARGCHCA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 10/90 (11%)
TGF_beta 599..700 CDD:278448 22/101 (22%)
Gdf15NP_001317616.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.