DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Tgfb3

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_033394.2 Gene:Tgfb3 / 21809 MGIID:98727 Length:412 Species:Mus musculus


Alignment Length:438 Identity:107/438 - (24%)
Similarity:178/438 - (40%) Gaps:90/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 TRDLHFLSITTNGFNDISNKRLRHRRS--LKKINRLNQNPK----KHQNYGDL------------ 356
            |..|...:.||..|..|..||:...|.  |.|: ||...|:    .|..|..|            
Mouse    19 TISLSLSTCTTLDFGHIKKKRVEAIRGQILSKL-RLTSPPEPSVMTHVPYQVLALYNSTRELLEE 82

  Fly   357 LRGE------QDTMNILLHFPLTNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSR--KN 413
            :.||      |:|            .::.::..:|.:.::...|...:.||. ..:|..|:  :.
Mouse    83 MHGEREEGCTQET------------SESEYYAKEIHKFDMIQGLAEHNELAV-CPKGITSKVFRF 134

  Fly   414 KISQISGNDNIERHCNFGDVNL-NQSNKNSSQQLTLKVYQLLSAN----RRRKITSRKIEFGNVG 473
            .:|.:..|........|..:.: |.|:|.:.|::.|  :|:|..:    ::|.|..:.:      
Mouse   135 NVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIEL--FQILRPDEHIAKQRYIGGKNL------ 191

  Fly   474 FQETR--TQWIEFDVTKAVRSWLNKSHENLGIE--IQCDKCKSIGARILSDFSPSTPPRSTASSD 534
              .||  .:|:.||||..||.||.:...|||:|  |.| .|.:        |.|        :.|
Mouse   192 --PTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHC-PCHT--------FQP--------NGD 237

  Fly   535 EHLNLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYV------HHR--SNHDSTWRKDKW- 590
            ...|:..|:.|...|..|...||..|:.::....:..:.::      .||  |....:.||.:. 
Mouse   238 ILENVHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGSQRKKRAL 302

  Fly   591 -TNNCYK-LHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQ 653
             ||.|:: |.:.||...|.:.|:...|::::.:||.:.|.:|.|.||...:....|:.:..|...
Mouse   303 DTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNT 367

  Fly   654 EDHKRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            .:.:.:..|||.|..||.|.||:......   |:...|:|.|..|.||
Mouse   368 LNPEASASPCCVPQDLEPLTILYYVGRTP---KVEQLSNMVVKSCKCS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 21/71 (30%)
TGF_beta 599..700 CDD:278448 28/100 (28%)
Tgfb3NP_033394.2 TGFb_propeptide 24..230 CDD:366248 54/230 (23%)
TGF_beta_TGFB3 312..412 CDD:381656 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7139
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.