DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mav and Tgfb2

DIOPT Version :9

Sequence 1:NP_524626.1 Gene:mav / 43804 FlyBaseID:FBgn0039914 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_001316036.1 Gene:Tgfb2 / 21808 MGIID:98726 Length:442 Species:Mus musculus


Alignment Length:297 Identity:77/297 - (25%)
Similarity:117/297 - (39%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 QSNKNSSQQLTLKVYQLLSANRRRKITSRKIEFGNVGFQETRT--QWIEFDVTKAVRSWLNKSHE 499
            |:.|....:..:::||:|.:......|.|.|:...|   :||.  :|:.||||.||:.||:....
Mouse   183 QNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVV---KTRAEGEWLSFDVTDAVQEWLHHKDR 244

  Fly   500 NLG--IEIQC--------------DKCKSIGARILSDFSPST-----------PPRSTASSDEHL 537
            |||  |.:.|              :|.:.:.||.......||           ..:.|:....||
Mouse   245 NLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHL 309

  Fly   538 NLMPVLNIIGHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHDSTWRKDKWTNNCY---KLHQ 599
            .||    ::....|.|||                           |:.||.:..:..|   .:..
Mouse   310 LLM----LLPSYRLESQQ---------------------------SSRRKKRALDAAYCFRNVQD 343

  Fly   600 RCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKRAPRPCC 664
            .||...|.:.||...|:::|.:||.::|.:|.|.||...:....|..:.||....:.:.:..|||
Mouse   344 NCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCC 408

  Fly   665 TPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS 701
            ....||.|.||:...|..   ||...|:|.|..|.||
Mouse   409 VSQDLEPLTILYYIGNTP---KIEQLSNMIVKSCKCS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mavNP_524626.1 TGFb_propeptide <442..506 CDD:279078 22/67 (33%)
TGF_beta 599..700 CDD:278448 32/100 (32%)
Tgfb2NP_001316036.1 TGFb_propeptide 21..256 CDD:279078 25/75 (33%)
TGF_beta 344..441 CDD:278448 32/99 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.